advanced search user manual

	Toxin Name β/κ-theraphotoxin-Hlv1a Source Species Haplopelma  lividum Toxin Group Theraphotoxin Description Neurotoxin from the venom of the spider Haplopelma lividum . β/κ-theraphotoxin-HLv1a blocks the Human and Rat voltage-gated sodium channel Nav1.3/SCN3A with an IC50 of 80 nM and 160 nM respectively. It also, inhibits partially (25%) the human Kv11.1/KCNH2/ERG channels at 175 μM. Discovered 2012 This toxin last updated on Aug 13, 2015 Taxonomy Current Taxonomy Historic Taxonomy Kingdom Animalia Phylum Arthropoda Class Arachnida Order Araneae Infra-order Mygalomorphae Family Theraphosidae Genus Haplopelma Species lividum "Haplopelma" "lividum" Biological Activity Neurotoxin Molecular Target ED50 IC50 Kd Pharmacophore Comment Sodium channel, voltage-gated (vertebrate): NaV1.3 80.0  nM Human NaV 1.3 Accessions Source Accession ArachnoServer AS001561 NCBI_Taxon 1184493 UniProt B3EWN3 UniProt HTX2_HAPLI Literature References Original Deposition References Meir A., Cherki R.S., Kolb E., Langut Y., Bajayo N. Submitted (MAY-2012) to UniProtKB. Novel peptides isolated from spider venom, and uses thereof. Protein Information Disulfide Bonds Posttranslational modifications Left Residue Right Residue Evidence 2 17 By homology 9 22 By homology 16 29 By homology Residue Number Type Symbol 33 C-terminal amidation NH₂ Sequences Peptide Sequences >as:β/κ-theraphotoxin-Hlv1a|sp:B3EWN3 Toxin from venom of the spider Haplopelma lividum that inhibits voltage-gated sodium channels ACKGLFVTCTPGKDECCPNHVCSSKHKWCKYKI Full BLAST BLAST mature toxin only Toxin Synonyms Synonym Type β/κ-theraphotoxin-Hlv1a Recommended full name β/κ-TRTX-Hlv1a Recommended abbreviation Beta/kappa-theraphotoxin-Hl2a Synonym Beta/kappa-TRTX-Hl2a Synonym Haplotoxin-2 Synonym
©2010 Queensland Facility for Advanced Bioinformatics (Version 3.0) We greatly appreciate your feedback, comments or questions Internal: log in